SLC13A2 antibody

Catalog No. ABIN635937

This anti-SLC13A2 antibody is a Rabbit Polyclonal antibody detecting SLC13A2 in WB. Suitable for Human.

Quick Overview for SLC13A2 antibody (ABIN635937)

Target: SLC13A2 (Solute Carrier Family 13 Member 2 (SLC13A2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC13A2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC13A2 Antibody

Purification: Affinity purified

Immunogen: SLC13 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PNAKGESMVSDGTVAIFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC13A2 Blocking Peptide, (ABIN5616179), is also available for use as a blocking control in assays to test for specificity of this SLC13A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC13A2

Target: SLC13A2 (Solute Carrier Family 13 Member 2 (SLC13A2))

Alternative Name: SLC13A2

Background: SLC13A2 belongs to the SLC13A transporter family, NADC subfamily. It is a multi-pass membrane protein. SLC13A2 cotransports of sodium ions and dicarboxylates such as succinate and citrate.

Molecular Weight: 64 kDa (MW of target protein)